Total number of results for Chaetophractus villosus are 1
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00024 |
SQAEFDKAAEEVKNLKTKPADDEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNQLKGTSKEDAMKSYIDKVEELKKKYGI
|
86 | Chaetophractus villosus | ACBP | Acyl-CoA-binding protein | 11342056#Cavagnari B.M., Sterin-Speziale N., Affanni J.M., Knudsen J., Santome J.A.#Acyl-CoA-binding protein in the armadillo Harderian gland: its primary structure and possible role in lipid secretion.# Biochim. Biophys. Acta 1545:314-325(2001). |